PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG231400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 431aa    MW: 45430 Da    PI: 5.3781
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG231400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.41.2e-151152344
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                         i n  +r  tf+kR +g+ KKA+ELSvLC+++va+++++  g
  Pavir.5KG231400.1.p 11 IPNRQQRAGTFAKRSEGLKKKAYELSVLCGVDVALVVAAAAG 52
                         679999*******************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.161152IPR002100Transcription factor, MADS-box
SMARTSM004324.7E-16165IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-17180IPR002100Transcription factor, MADS-box
CDDcd002664.86E-15240No hitNo description
PRINTSPR004043.6E-10323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-141150IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MGRRKVSMGL IPNRQQRAGT FAKRSEGLKK KAYELSVLCG VDVALVVAAA AGDGGGGAAA  60
DVWESREGVL ARYRALGAEA RARHTHRAYL GAELGKAEAK LARVRQGGPD ALARCDRALD  120
GVATEEEARR VLDALDAAIR AAEDRRRALG LPPVDDDAED GVVLDGVAPL NFAAAGHDYG  180
LQNASGSGAN SYQQAMWGGN GFHFQQGSAA DMQHTGYAFQ QQYTTTGGSY HPQIAPNMYS  240
NDGDNNNGHL ADAYQPRDPM QQHGYGFHCA DASYFAVPPM WSADEPRHDM LLLEYPSADD  300
AGLNYADTPV ARGAQGVGGS CFASGNFVYS PPALSLAMNT TAGDFVNNAP SAAAAASYTM  360
GGSGDNFTNA MPAQPLAMSY GGDLTIASRY AAQWQAPPNP QRAGGDQRPS IEQLHYLSDL  420
EDTQRHLCGN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463078.11e-112hypothetical protein SORBIDRAFT_02g037430
TrEMBLK3XPW30.0K3XPW3_SETIT; Uncharacterized protein
STRINGSi003942m1e-180(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45722960
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.22e-08MIKC_MADS family protein